PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C004145P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 324aa    MW: 36567 Da    PI: 7.613
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C004145P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
   MELO3C004145P1 14 KGLWSPEEDEKLLNYITIHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.41.9e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
   MELO3C004145P1  67 RGPFSQQEEDLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.582961IPR017930Myb domain
SuperFamilySSF466896.36E-3012108IPR009057Homeodomain-like
SMARTSM007176.5E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001672.22E-111761No hitNo description
PROSITE profilePS5129424.962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2665117IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PfamPF002493.1E-1367110IPR001005SANT/Myb domain
CDDcd001678.19E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT IHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEEDLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLKQKG  120
IDPHTHKPLI EKEIINNSDN NDSIIITSDD KKSHEKTFPI EEVVPTNSTT TRKSIESCFD  180
MSTTTTSTTC NFSNFHQLND GSSLMDLPII QHNNTNDATP FEAAISNLFF PSSNSCGVAH  240
VRPSISLLPS ENNPSSIVSS TSEVVVHNNN NNNSNNGFLW HSDDQFLQTA SVLMKNDWHH  300
LQINHRHATL QAEILGQPTF PKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818470.0LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453024.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH63e-89MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0A0LGL11e-147A0A0A0LGL1_CUCSA; Uncharacterized protein
STRINGGLYMA10G28250.12e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-84myb domain protein 50